PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G27630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family TALE
Protein Properties Length: 620aa    MW: 64610.1 Da    PI: 7.111
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G27630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-095165531954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  LPERR03G27630.1 516 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 553
                      664459******************************88 PP

2BELL81.79.2e-273974472272
             BELL  22 rYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       Y++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  LPERR03G27630.1 397 AYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 447
                      5***********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.0E-41334445IPR006563POX domain
PfamPF075269.6E-6339366IPR006563POX domain
PfamPF075261.1E-23397444IPR006563POX domain
PROSITE profilePS5007112.6494557IPR001356Homeobox domain
CDDcd000866.11E-13497558No hitNo description
SMARTSM003891.6E-9497561IPR001356Homeobox domain
SuperFamilySSF466892.1E-17498564IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-29500563IPR009057Homeodomain-like
PfamPF059203.0E-18514553IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MGIAAPPCHH QQGNTTTFVS HHHHQNTKII TSPAAISGGG VRPDTASSMS HSQGFHHGSG  60
GGGGFGFSSG GDGGHHDEQH HQQHVAQQSR RDKLRVQGGF DPAAAAGHGL LQIDGDEHGE  120
PVAAAAAMYD HAEAAAGASN MLSEMFNFPS QPPPTAGPSA TELLASQMNA NYARFGAGAA  180
GWFASAGGRT GLGSLGETSS PKHHQQQQPG GGAAMASLAA ADPAAAMHLF LMNPHQQNQQ  240
SRSSNSPPPP SDHEAAAAAA AAFQAFGGGA FAGAGAVEGQ GLSLSLSSSL QQQAEEQLRV  300
RDGVLYFNRQ QQLTPMALHG GGGGGVAPVG YGPAGVAGVL RNSKYTRAAQ ELLEEFCSVG  360
RGQIKGGAGG GGRNPKGGNG GGGGASSSGA AQSPPSAYNH YCDQMQMVVN FFDSVMGFGA  420
ATPYTALAQK AMSRHFRCLK DAIAAQLRHT CELLGEKDAG TSSGLTKGET PRLRAIDQSL  480
RQQRAFHHMG IMEQEAWRPQ RGLPERSVNI LRSWLFEHFL HPYPSDADKH LLARQTGLSR  540
NQVSNWFINA RVRLWKPMIE EMYQQECKEF DGSSSAAAAA GDDPSGAGDD THSPTTTGAA  600
QHHQHRLEHG GASHGFSCDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A8e-18503561159Homeobox protein Meis2
5bng_B8e-18503561159Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1364372KGGAGGGGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2874760.0AK287476.1 Oryza sativa Japonica Group cDNA, clone: J043023B19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLA0A0D9VYM10.0A0A0D9VYM1_9ORYZ; Uncharacterized protein
STRINGMLOC_58467.30.0(Hordeum vulgare)
STRINGOB03G40160.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-102BEL1-like homeodomain 4